PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_0F75B411F.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 271aa    MW: 29322.9 Da    PI: 4.7025
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_0F75B411F.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB62.11.2e-192731485
                  NF-YB 14 srimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                           ++i+k++lP + ++++d+++++ ec +efi +++se++d c r+++kti+++ ++ al +lGf++yve++ +
  Traes_3AL_0F75B411F.2  2 TKIIKEMLPPDVRVARDTQDLLVECCVEFINLLSSESNDVCSRDDKKTIAPEHVIRALQDLGFKEYVEEVYA 73
                           68******************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.44E-292120IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.5E-322120IPR009072Histone-fold
PfamPF008081.6E-15259IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MTKIIKEMLP PDVRVARDTQ DLLVECCVEF INLLSSESND VCSRDDKKTI APEHVIRALQ  60
DLGFKEYVEE VYAAYEQHKL ETLDSPKATK FTGIEMTEEE AVAEQQRMFA EARARMNNGA  120
AKPKEPALEP QNQPQQPPQP HLQLHPQAQQ PPQPQPQLHY PQSQQPLQPF TQAPPQQPLH  180
PQLQQYTQAP PQQPLQPPLQ LYPQAQPEQP LQPQSSGSTT GTCVISAAAP SATGTTAAAT  240
SAPAIPAIST AAPSATPADA SAAAATSTPA T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-29111321133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4649030.0AF464903.1 Triticum aestivum repressor protein (Dr1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235094.11e-103PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLW5CAL80.0W5CAL8_WHEAT; Uncharacterized protein
STRINGBRADI3G34930.11e-102(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-58nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]